PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1085s0045.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 199aa    MW: 22010.4 Da    PI: 8.4595
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1085s0045.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.71.7e-24959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krienks rqvtfskRrng++ KA  LSvLCda va++++s +gkly +ss
  Cagra.1085s0045.1.p  9 KRIENKSSRQVTFSKRRNGLIEKARQLSVLCDASVALLVVSASGKLYSFSS 59
                         79***********************************************96 PP

2K-box38.64.5e-141021643698
                K-box  36 RhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                           +l+  ++++ s+  L qLe++Le++l+  R+kK+el+l+ +e+l++kek l+een+ L +++
  Cagra.1085s0045.1.p 102 SKLVESNVSNVSVDSLVQLEEHLETALSVTRAKKTELMLKLVENLKEKEKLLKEENQVLASQM 164
                          56666778999***********************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.955161IPR002100Transcription factor, MADS-box
SMARTSM004327.9E-35160IPR002100Transcription factor, MADS-box
CDDcd002659.11E-38278No hitNo description
SuperFamilySSF554553.01E-28277IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.5E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.33980170IPR002487Transcription factor, K-box
PfamPF014862.4E-10102164IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009910Biological Processnegative regulation of flower development
GO:0010048Biological Processvernalization response
GO:0042752Biological Processregulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0043234Cellular Componentprotein complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MGRKKLEIKR IENKSSRQVT FSKRRNGLIE KARQLSVLCD ASVALLVVSA SGKLYSFSSG  60
DNLVKILDRY GKQHADDLKA LDLQSKSLNY GSHHELLDLV ESKLVESNVS NVSVDSLVQL  120
EEHLETALSV TRAKKTELML KLVENLKEKE KLLKEENQVL ASQMGKNHVV VGAETEMMEM  180
SPAGQISDNL PVTLPLLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D3e-17270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-17270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-17270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A3e-17270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J4e-17270168Myocyte-specific enhancer factor 2A
3p57_I4e-17270168Myocyte-specific enhancer factor 2A
3p57_D4e-17270168Myocyte-specific enhancer factor 2A
3p57_C4e-17270168Myocyte-specific enhancer factor 2A
3p57_B4e-17270168Myocyte-specific enhancer factor 2A
3p57_A4e-17270168Myocyte-specific enhancer factor 2A
3kov_J4e-17270168Myocyte-specific enhancer factor 2A
3kov_I4e-17270168Myocyte-specific enhancer factor 2A
3kov_B4e-17270168Myocyte-specific enhancer factor 2A
3kov_A4e-17270168Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00079ChIP-seqTransfer from AT5G10140Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9929920.0JQ992992.1 Capsella rubella ecotype 690 flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9929930.0JQ992993.1 Capsella rubella ecotype 697 flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9929950.0JQ992995.1 Capsella rubella ecotype 762 flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9929960.0JQ992996.1 Capsella rubella ecotype 844 flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9929970.0JQ992997.1 Capsella rubella ecotype 879 flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9929980.0JQ992998.1 Capsella rubella ecotype 907 flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9929990.0JQ992999.1 Capsella rubella ecotype 925 flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9930000.0JQ993000.1 Capsella rubella ecotype 1204 flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9930010.0JQ993001.1 Capsella rubella ecotype 1207 flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9930020.0JQ993002.1 Capsella rubella ecotype 1208 flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9930030.0JQ993003.1 Capsella rubella ecotype 1209 flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9930040.0JQ993004.1 Capsella rubella ecotype 1215 flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9930050.0JQ993005.1 Capsella rubella ecotype 1311 flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9930060.0JQ993006.1 Capsella rubella ecotype 1377 flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9930080.0JQ993008.1 Capsella rubella ecotype 1453 flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9930090.0JQ993009.1 Capsella rubella ecotype 1482 flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9930100.0JQ993010.1 Capsella rubella ecotype MTE flowering locus C protein (FLC) mRNA, complete cds.
GenBankJQ9930110.0JQ993011.1 Capsella rubella ecotype RIAH flowering locus C protein (FLC) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399505.11e-117hypothetical protein EUTSA_v10014726mg
SwissprotQ9S7Q71e-116FLC_ARATH; MADS-box protein FLOWERING LOCUS C
TrEMBLK4MLT21e-138K4MLT2_9BRAS; Flowering locus C protein
STRINGAT5G10140.11e-114(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM9861987
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10140.12e-95MIKC_MADS family protein